PDB entry 3sz8

View 3sz8 on RCSB PDB site
Description: Crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from Burkholderia pseudomallei
Class: transferase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2011-07-18, released 2011-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.185
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase 2
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: kdsA, kdsA2, BURPS1710b_3264
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JP68 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d3sz8a1, d3sz8a2
  • Chain 'B':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase 2
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: kdsA, kdsA2, BURPS1710b_3264
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JP68 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d3sz8b1, d3sz8b2
  • Chain 'C':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase 2
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: kdsA, kdsA2, BURPS1710b_3264
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sz8c_
  • Chain 'D':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase 2
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: kdsA, kdsA2, BURPS1710b_3264
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JP68 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d3sz8d1, d3sz8d2
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sz8A (A:)
    gpgsmnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasf
    dkanrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpafl
    arqtdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlv
    vdmlgfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfl
    eahpdpdrarcdgpsalplhqlegllsqmkaiddlvkrmpaleir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sz8A (A:)
    smnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasfdka
    nrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpaflarq
    tdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlvvdm
    lgfrqmaettggcpvifdvthslqvldlaragiavgiaglfleahpdpdrarcdgpsalp
    lhqlegllsqmkaiddlvkrmpal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sz8B (B:)
    gpgsmnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasf
    dkanrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpafl
    arqtdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlv
    vdmlgfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfl
    eahpdpdrarcdgpsalplhqlegllsqmkaiddlvkrmpaleir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sz8B (B:)
    smnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasfdka
    nrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpaflarq
    tdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlvvdm
    lgfrqmaettggcpvifdvthslrqvldlaragiavgiaglfleahpdpdrapsalplhq
    legllsqmkaiddlvkrmpale
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3sz8C (C:)
    gpgsmnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasf
    dkanrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpafl
    arqtdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlv
    vdmlgfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfl
    eahpdpdrarcdgpsalplhqlegllsqmkaiddlvkrmpaleir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sz8C (C:)
    mnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasfdkan
    rssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpaflarqt
    dlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlvvdml
    gfrqmaettggcpvifdvthslqvldlaragiavgiaglfleahpdpdrarcdgpsalpl
    hqlegllsqmkaiddlvkrmpale
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3sz8D (D:)
    gpgsmnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasf
    dkanrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpafl
    arqtdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlv
    vdmlgfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfl
    eahpdpdrarcdgpsalplhqlegllsqmkaiddlvkrmpaleir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sz8D (D:)
    smnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasfdka
    nrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpaflarq
    tdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlvvdm
    lgfrqmaettggcpvifdvthslqvldlaragiavgiaglfleahpdpdrarpsalplhq
    legllsqmkaiddlvkrmpale