PDB entry 3sz1

View 3sz1 on RCSB PDB site
Description: Human PPAR gamma ligand binding domain in complex with luteolin and myristic acid
Class: transcription
Keywords: ppar gamma, nuclear receptor, luteolin, transcription
Deposited on 2011-07-18, released 2012-03-21
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.208
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3sz1a_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3sz1b_
  • Heterogens: KNA, LU2, MYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sz1A (A:)
    gshmlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmge
    dkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllk
    ygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalel
    ddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkm
    tdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sz1A (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikeva
    irifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdg
    vlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrp
    gllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikk
    tetdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sz1B (B:)
    gshmlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmge
    dkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllk
    ygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalel
    ddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkm
    tdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sz1B (B:)
    esadlralakhlydsyiksfpltkakarailtgkspfviydmnslmmgedkikfkhitke
    vairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnk
    dgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgd
    rpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvi
    kktetdlhpllqeiykdl