PDB entry 3syx

View 3syx on RCSB PDB site
Description: Crystal Structure of the WH1 domain from human sprouty-related, EVH1 domain-containing protein. Northeast Structural Genomics Consortium Target HR5538B.
Class: signaling protein
Keywords: WH1 domain, Human sprouty-related, EVH1 domain-containing protein, Q7Z699, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, PSI-Biology, SIGNALING PROTEIN
Deposited on 2011-07-18, released 2011-08-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.23
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Sprouty-related, EVH1 domain-containing protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: Spred1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7Z699 (11-End)
    • expression tag (8-10)
  Domains in SCOPe 2.04: d3syxa_
• Heterogens: YT3, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3syxA (A:)
  mghhhhhhshmsyarvravvmtrddssggwlplggsglssvtvfkvphqeengcadffir
  gerlrdkmvvlecmlkkdliynkvtptfhhwkiddkkfgltfqspadarafdrgirraie
  disqgcpesk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3syxA (A:)
  shmsyarvravvmtrddssggwlplggsglssvtvfkvphqeengcadffirgerlrdkm
  vvlecmlkkdliynkvtptfhhwkiddkkfgltfqspadarafdrgirraiedisqgc