PDB entry 3swo

View 3swo on RCSB PDB site
Description: Crystal structure of a glutaryl-coa dehydrogenase from mycobacterium smegmatis in complex with FADH2
Class: oxidoreductase
Keywords: SSGCID, GLUTARYL-COA DEHDROGENASE, MYCOBACERIUM SMEGMATIS, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, FADH2, OXIDOREDUCTASE
Deposited on 2011-07-14, released 2011-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: MSMEG_6686
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3swoa1, d3swoa2
  • Chain 'B':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: MSMEG_6686
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3swob1, d3swob2
  • Chain 'C':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: MSMEG_6686
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3swoc1, d3swoc2
  • Chain 'D':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: MSMEG_6686
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3swod1, d3swod2
  • Heterogens: FDA, EDO, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3swoA (A:)
    gsmtltapskkstyaplelfdtdrlldqderdiaatvrqfvdtrlkpnvegwfesatlps
    elakefgnlgvlgmhlqgygcagtnavsyglacmeleagdsgfrsfvsvqgslsmfsiyr
    ygseeqknewlprlaagdaigcfgltepdfgsnpagmrtrarrdgsdwilngtkmwitng
    nladvatvwaqtddgirgflvptdtpgftaneihrklslrasvtselvldnvrlpasaql
    plaeglsaplsclnearfgivfgalgaardslettiaytqsrevfdkplsnyqltqekla
    nmtvelgkgmllaihlgrikdaegvrpeqislgklnnvreaiaiarecrtllggsgitle
    ysplrhannlesvltyegtsemhllsigkaltgkaafrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3swoA (A:)
    kstyaplelfdtdrlldqderdiaatvrqfvdtrlkpnvegwfesatlpselakefgnlg
    vlgmhlqgygcagtnavsyglacmeleagdsgfrsfvsvqgslsmfsiyrygseeqknew
    lprlaagdaigcfgltepdfgsnpagmrtrarrdgsdwilngtkmwitngnladvatvwa
    qtddgirgflvptdtpgftaneihrklslrasvtselvldnvrlpasaqlplaeglsapl
    sclnearfgivfgalgaardslettiaytqsrevfdkplsnyqltqeklanmtvelgkgm
    llaihlgrikdaegvrpeqislgklnnvreaiaiarecrtllggsgitleysplrhannl
    esvltyegtsemhllsigkaltgkaafr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3swoB (B:)
    gsmtltapskkstyaplelfdtdrlldqderdiaatvrqfvdtrlkpnvegwfesatlps
    elakefgnlgvlgmhlqgygcagtnavsyglacmeleagdsgfrsfvsvqgslsmfsiyr
    ygseeqknewlprlaagdaigcfgltepdfgsnpagmrtrarrdgsdwilngtkmwitng
    nladvatvwaqtddgirgflvptdtpgftaneihrklslrasvtselvldnvrlpasaql
    plaeglsaplsclnearfgivfgalgaardslettiaytqsrevfdkplsnyqltqekla
    nmtvelgkgmllaihlgrikdaegvrpeqislgklnnvreaiaiarecrtllggsgitle
    ysplrhannlesvltyegtsemhllsigkaltgkaafrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3swoB (B:)
    tyaplelfdtdrlldqderdiaatvrqfvdtrlkpnvegwfesatlpselakefgnlgvl
    gmhlqgygcagtnavsyglacmeleagdsgfrsfvsvqgslsmfsiyrygseeqknewlp
    rlaagdaigcfgltepdfgsnpagmrtrarrdgsdwilngtkmwitngnladvatvwaqt
    ddgirgflvptdtpgftaneihrklslrasvtselvldnvrlpasaqlplaeglsaplsc
    lnearfgivfgalgaardslettiaytqsrevfdkplsnyqltqeklanmtvelgkgmll
    aihlgrikdaegvrpeqislgklnnvreaiaiarecrtllggsgitleysplrhannles
    vltyegtsemhllsigkaltgkaafr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3swoC (C:)
    gsmtltapskkstyaplelfdtdrlldqderdiaatvrqfvdtrlkpnvegwfesatlps
    elakefgnlgvlgmhlqgygcagtnavsyglacmeleagdsgfrsfvsvqgslsmfsiyr
    ygseeqknewlprlaagdaigcfgltepdfgsnpagmrtrarrdgsdwilngtkmwitng
    nladvatvwaqtddgirgflvptdtpgftaneihrklslrasvtselvldnvrlpasaql
    plaeglsaplsclnearfgivfgalgaardslettiaytqsrevfdkplsnyqltqekla
    nmtvelgkgmllaihlgrikdaegvrpeqislgklnnvreaiaiarecrtllggsgitle
    ysplrhannlesvltyegtsemhllsigkaltgkaafrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3swoC (C:)
    tyaplelfdtdrlldqderdiaatvrqfvdtrlkpnvegwfesatlpselakefgnlgvl
    gmhlqgygcagtnavsyglacmeleagdsgfrsfvsvqgslsmfsiyrygseeqknewlp
    rlaagdaigcfgltepdfgsnpagmrtrarrdgsdwilngtkmwitngnladvatvwaqt
    ddgirgflvptdtpgftaneihrklslrasvtselvldnvrlpasaqlplaeglsaplsc
    lnearfgivfgalgaardslettiaytqsrevfdkplsnyqltqeklanmtvelgkgmll
    aihlgrikdaegvrpeqislgklnnvreaiaiarecrtllggsgitleysplrhannles
    vltyegtsemhllsigkaltgkaafr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3swoD (D:)
    gsmtltapskkstyaplelfdtdrlldqderdiaatvrqfvdtrlkpnvegwfesatlps
    elakefgnlgvlgmhlqgygcagtnavsyglacmeleagdsgfrsfvsvqgslsmfsiyr
    ygseeqknewlprlaagdaigcfgltepdfgsnpagmrtrarrdgsdwilngtkmwitng
    nladvatvwaqtddgirgflvptdtpgftaneihrklslrasvtselvldnvrlpasaql
    plaeglsaplsclnearfgivfgalgaardslettiaytqsrevfdkplsnyqltqekla
    nmtvelgkgmllaihlgrikdaegvrpeqislgklnnvreaiaiarecrtllggsgitle
    ysplrhannlesvltyegtsemhllsigkaltgkaafrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3swoD (D:)
    tyaplelfdtdrlldqderdiaatvrqfvdtrlkpnvegwfesatlpselakefgnlgvl
    gmhlqgygcagtnavsyglacmeleagdsgfrsfvsvqgslsmfsiyrygseeqknewlp
    rlaagdaigcfgltepdfgsnpagmrtrarrdgsdwilngtkmwitngnladvatvwaqt
    ddgirgflvptdtpgftaneihrklslrasvtselvldnvrlpasaqlplaeglsaplsc
    lnearfgivfgalgaardslettiaytqsrevfdkplsnyqltqeklanmtvelgkgmll
    aihlgrikdaegvrpeqislgklnnvreaiaiarecrtllggsgitleysplrhannles
    vltyegtsemhllsigkaltgkaafr