PDB entry 3svh

View 3svh on RCSB PDB site
Description: Crystal Structure of the bromdomain of human CREBBP in complex with a 3,5-dimethylisoxazol ligand
Class: unknown function
Keywords: isoxazole, Bromodomain, Structural Genomics, Structural Genomics Consortium, SGC, UNKNOWN FUNCTION
Deposited on 2011-07-12, released 2011-08-10
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CBP, CREBBP
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CBP, CREBBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3svhb_
  • Heterogens: KRG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3svhB (B:)
smrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlsti
krkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

    Sequence, based on observed residues (ATOM records): (download) 
    >3svhB (B:)
rkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikr
kldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg