PDB entry 3sty

View 3sty on RCSB PDB site
Description: Crystal Structure of tomato Methylketone Synthase I T18A mutant
Class: hydrolase
Keywords: methylketone, alpha/beta hydrolase, decarboxylase, HYDROLASE
Deposited on 2011-07-11, released 2012-05-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.196
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylketone synthase 1
    Species: Lycopersicon hirsutum f. glabratum [TaxId:283673]
    Gene: MKS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot E0YCS2 (Start-266)
      • engineered mutation (19)
    Domains in SCOPe 2.06: d3stya_
  • Chain 'B':
    Compound: Methylketone synthase 1
    Species: Lycopersicon hirsutum f. glabratum [TaxId:283673]
    Gene: MKS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot E0YCS2 (Start-266)
      • engineered mutation (19)
    Domains in SCOPe 2.06: d3styb_
  • Heterogens: DKA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3styA (A:)
    gsmeksmspfvkkhfvlvhaafhgawcwykivalmrssghnvtaldlgasginpkqalqi
    pnfsdylsplmefmaslpanekiilvghalgglaiskametfpekisvavflsglmpgpn
    idattvctkagsavlgqldncvtyengptnppttliagpkflatnvyhlspiedlalata
    lvrplylylaediskevvlsskrygsvkrvfivatendalkkeflklmieknppdevkei
    egsdhvtmmskpqqlfttllsiankyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3styA (A:)
    fvkkhfvlvhaafhgawcwykivalmrssghnvtaldlgasginpkqalqipnfsdylsp
    lmefmaslpanekiilvghalgglaiskametfpekisvavflsglmpgpnidattvctk
    agsavlgqldncvtyengptnppttliagpkflatnvyhlspiedlalatalvrplylyl
    aediskevvlsskrygsvkrvfivatendalkkeflklmieknppdevkeiegsdhvtmm
    skpqqlfttllsiankyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3styB (B:)
    gsmeksmspfvkkhfvlvhaafhgawcwykivalmrssghnvtaldlgasginpkqalqi
    pnfsdylsplmefmaslpanekiilvghalgglaiskametfpekisvavflsglmpgpn
    idattvctkagsavlgqldncvtyengptnppttliagpkflatnvyhlspiedlalata
    lvrplylylaediskevvlsskrygsvkrvfivatendalkkeflklmieknppdevkei
    egsdhvtmmskpqqlfttllsiankyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3styB (B:)
    pfvkkhfvlvhaafhgawcwykivalmrssghnvtaldlgasginpkqalqipnfsdyls
    plmefmaslpanekiilvghalgglaiskametfpekisvavflsglmpgpnidattvct
    kagsavlgqldncvtyengptnppttliagpkflatnvyhlspiedlalatalvrplyly
    laediskevvlsskrygsvkrvfivatendalkkeflklmieknppdevkeiegsdhvtm
    mskpqqlfttllsiankyk