PDB entry 3stv

View 3stv on RCSB PDB site
Description: Crystal Structure of tomato Methylketone Synthase I complexed with 3-hydroxyoctanoate
Class: hydrolase
Keywords: methylketone, alpha/beta hydrolase, decarboxylase, HYDROLASE
Deposited on 2011-07-11, released 2012-05-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.202
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylketone synthase 1
    Species: Lycopersicon hirsutum f. glabratum [TaxId:283673]
    Gene: MKS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3stva_
  • Chain 'B':
    Compound: Methylketone synthase 1
    Species: Lycopersicon hirsutum f. glabratum [TaxId:283673]
    Gene: MKS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3stvb_
  • Heterogens: 3HO, BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3stvA (A:)
    gsmeksmspfvkkhfvlvhtafhgawcwykivalmrssghnvtaldlgasginpkqalqi
    pnfsdylsplmefmaslpanekiilvghalgglaiskametfpekisvavflsglmpgpn
    idattvctkagsavlgqldncvtyengptnppttliagpkflatnvyhlspiedlalata
    lvrplylylaediskevvlsskrygsvkrvfivatendalkkeflklmieknppdevkei
    egsdhvtmmskpqqlfttllsiankyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3stvA (A:)
    fvkkhfvlvhtafhgawcwykivalmrssghnvtaldlgasginpkqalqipnfsdylsp
    lmefmaslpanekiilvghalgglaiskametfpekisvavflsglmpgpnidattvctk
    agsavlgqldncvtyengptnppttliagpkflatnvyhlspiedlalatalvrplylyl
    aediskevvlsskrygsvkrvfivatendalkkeflklmieknppdevkeiegsdhvtmm
    skpqqlfttllsiankyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3stvB (B:)
    gsmeksmspfvkkhfvlvhtafhgawcwykivalmrssghnvtaldlgasginpkqalqi
    pnfsdylsplmefmaslpanekiilvghalgglaiskametfpekisvavflsglmpgpn
    idattvctkagsavlgqldncvtyengptnppttliagpkflatnvyhlspiedlalata
    lvrplylylaediskevvlsskrygsvkrvfivatendalkkeflklmieknppdevkei
    egsdhvtmmskpqqlfttllsiankyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3stvB (B:)
    spfvkkhfvlvhtafhgawcwykivalmrssghnvtaldlgasginpkqalqipnfsdyl
    splmefmaslpanekiilvghalgglaiskametfpekisvavflsglmpgpnidattvc
    tkagsavlgqldncvtyengptnppttliagpkflatnvyhlspiedlalatalvrplyl
    ylaediskevvlsskrygsvkrvfivatendalkkeflklmieknppdevkeiegsdhvt
    mmskpqqlfttllsiankyk