PDB entry 3srv

View 3srv on RCSB PDB site
Description: Crystal structure of spleen tyrosine kinase (SYK) in complex with a diaminopyrimidine carboxamide inhibitor
Class: transferase/transferase inhibitor
Keywords: SK363, SYK, non-receptor tyrosine kinase, spleen tyrosine kinase, TRANSFERASE, PHOSPHORYLATION, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-07-07, released 2011-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.188
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3srva_
  • Chain 'B':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3srvb_
  • Heterogens: S19, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3srvA (A:)
    gpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdell
    aeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqv
    smgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkw
    yapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcp
    remydlmnlcwtydvenrpgfaavelrlrnyyydvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3srvA (A:)
    yldrklltledkelgnfgtvkkgyyqmkkvvktvavkilkalkdellaeanvmqqldnpy
    ivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyleesnfv
    hrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecinyykfss
    ksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwty
    dvenrpgfaavelrlrnyyydvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3srvB (B:)
    gpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdell
    aeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqv
    smgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkw
    yapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcp
    remydlmnlcwtydvenrpgfaavelrlrnyyydvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3srvB (B:)
    yldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilpalkdellaeanvmqqldn
    pyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyleesn
    fvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecinyykf
    ssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcw
    tydvenrpgfaavelrlrnyyyd