PDB entry 3sru

View 3sru on RCSB PDB site
Description: S. aureus Dihydrofolate Reductase complexed with novel 7-aryl-2,4-diaminoquinazolines
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: dihydrofolate reductase, DHFR, drug design, enzyme inhibitors, folate, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2011-07-07, released 2011-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.183
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: dihydrofolate reductase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3srux_
  • Heterogens: NAP, Q26, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download) 
    >3sruX (X:)
mtlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrn
vvltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrg
dtffppytfedwevassvegkldekntiphtflhlirkklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3sruX (X:)
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk