PDB entry 3spk

View 3spk on RCSB PDB site
Description: Tipranavir in Complex with a Human Immunodeficiency Virus Type 1 Protease Variant
Class: hydorlase/hydorlase inhibitor
Keywords: tipranavir, multi-drug resistant HIV-1 protease, HYDORLASE-HYDORLASE INHIBITOR complex
Deposited on 2011-07-01, released 2011-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 1.24 Å
R-factor: 0.177
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: human immunodeficiency virus type 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q000H7 (0-98)
      • see remark 999 (6)
      • conflict (24)
      • conflict (34)
      • see remark 999 (35)
      • see remark 999 (45)
    Domains in SCOPe 2.07: d3spka_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: human immunodeficiency virus type 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q000H7 (0-98)
      • see remark 999 (6)
      • conflict (24)
      • conflict (34)
      • see remark 999 (35)
      • see remark 999 (45)
    Domains in SCOPe 2.07: d3spkb_
  • Heterogens: TPV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3spkA (A:)
    pqitlwkrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
    qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3spkB (B:)
    pqitlwkrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
    qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf