PDB entry 3so9

View 3so9 on RCSB PDB site
Description: Darunavir in Complex with a Human Immunodeficiency Virus Type 1 Protease Variant
Class: hydorlase/hydorlase inhibitor
Keywords: multi-drug resistance, HIV-1 protease, darunavir, protease inhibitor, HYDORLASE-HYDORLASE INHIBITOR complex
Deposited on 2011-06-30, released 2011-10-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.218
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human Immunodeficiency Virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q000H7 (0-98)
    • see remark 999 (6)
    • conflict (24)
    • conflict (34)
    • see remark 999 (35)
    • see remark 999 (45)
  Domains in SCOPe 2.01: d3so9a_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human Immunodeficiency Virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q000H7 (0-98)
    • see remark 999 (6)
    • conflict (24)
    • conflict (34)
    • see remark 999 (35)
    • see remark 999 (45)
  Domains in SCOPe 2.01: d3so9b_
• Heterogens: 017, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3so9A (A:)
  pqitlwkrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
  qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3so9B (B:)
  pqitlwkrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
  qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf