PDB entry 3sme

View 3sme on RCSB PDB site
Description: Structure of PTP1B inactivated by H2O2/bicarbonate
Class: Hydrolase
Keywords: HYDROLASE, SULFENYL AMIDE BOND BETWEEN CYS 215 and SER 216
Deposited on 2011-06-27, released 2011-10-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.198
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein phosphatase non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTP1B, PTPN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3smea_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3smeA (A:)
    ghmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsrik
    lhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgs
    lkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhytt
    wpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkr
    kdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed
    

    Sequence, based on observed residues (ATOM records): (download)
    >3smeA (A:)
    memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
    pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfim