PDB entry 3sli

View 3sli on RCSB PDB site
Description: leech intramolecular trans-sialidase complexed with 2,7-anhydro-neu5ac prepared by soaking with 3'-sialyllactose
Class: hydrolase
Keywords: hydrolase, intramolecular trans-sialidase, neuraminidase
Deposited on 1998-10-03, released 1999-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intramolecular trans-sialidase
    Species: Macrobdella decora [TaxId:6405]
    Gene: T7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3slia1, d3slia2
  • Heterogens: SKD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sliA (A:)
    ipegilmeknnvdiaegqgysldqeagakyvkamtqgtiilsykstsengiqslfsvgns
    tagnqdrhfhiyitnsggigielrntdgvfnytldrpasvralykgervfntvalkadaa
    nkqcrlfangellatldkdafkfisditgvdnvtlggtkrqgkiaypfggtigdikvysn
    alsdeeliqatgvttygenifyagdvtesnyfripslltlstgtvisaadaryggthdsk
    skiniafakstdggntwseptlplkfddyiaknidwprdsvgknvqiqgsasyidpvlle
    dkltkriflfadlmpagigssnasvgsgfkevngkkylklrwhkdagraydytirekgvi
    yndatnqptefrvdgeynlyqhdtnltckqydynfsgnnliesktdvdvnmnifyknsvf
    kafptnylamrysddegaswsdldivssfkpevskflvvgpgigkqistgenagrllvpl
    yskssaelgfmysddhgdnwtyveadnltggataeaqivempdgslktylrtgsnciaev
    tsidggetwsdrvplqgisttsygtqlsvinysqpidgkpaiilsspnatngrkngkiwi
    glvndtgntgidkysvewkysyavdtpqmgysysclaelpdgqvgllyekydswsrnelh
    lkdilkfekysiseltgqa