PDB entry 3skk

View 3skk on RCSB PDB site
Description: Crystal structure of human arginase I in complex with the inhibitor FABH, Resolution 1.70 A, twinned structure
Class: hydrolase/hydrolase inhibitor
Keywords: ABH inhibitor derivative, twinning, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-06-22, released 2011-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.14
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3skka_
  • Chain 'B':
    Compound: Arginase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3skkb_
  • Heterogens: MN, 4U7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3skkA (A:)
    msaksrtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipn
    dspfqivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgv
    iwvdahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglr
    dvdpgehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsf
    tpatgtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavait
    lacfglaregnhkpidylnppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3skkA (A:)
    rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq
    ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda
    htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdpg
    ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg
    tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg
    laregnhkpidyln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3skkB (B:)
    msaksrtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipn
    dspfqivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgv
    iwvdahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglr
    dvdpgehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsf
    tpatgtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavait
    lacfglaregnhkpidylnppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3skkB (B:)
    rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq
    ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda
    htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdpg
    ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg
    tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg
    laregnhkpidyln