PDB entry 3sjz

View 3sjz on RCSB PDB site
Description: The structure of aIF2gamma subunit delta 41-45 from archaeon Sulfolobus solfataricus complexed with GDP and GDPNP
Class: translation
Keywords: Zinc Finger, Initiate translation, tRNA binding, mRNA binding, GTP binding, TRANSLATION
Deposited on 2011-06-22, released 2012-07-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-07-04, with a file datestamp of 2012-06-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.192
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor 2 subunit gamma
    Species: Sulfolobus solfataricus P2 [TaxId:273057]
    Gene: eif2g, SSO0412
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3sjza1, d3sjza2, d3sjza3
  • Heterogens: GDP, GNP, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3sjzA (A:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseetiklgyaetnigvcesckkpe
    ayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpq
    pqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsal
    hkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqgl
    fkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyldpslt
    kadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsvgsstt
    lgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei