PDB entry 3sjn

View 3sjn on RCSB PDB site
Description: Crystal structure of enolase Spea_3858 (target EFI-500646) from Shewanella pealeana with magnesium bound
Class: lyase
Keywords: enolase, magnesium binding site, lyase
Deposited on 2011-06-21, released 2011-07-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.161
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3858
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8H9D1 (2-373)
      • expression tag (1)
    Domains in SCOPe 2.06: d3sjna1, d3sjna2, d3sjna3
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3858
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8H9D1 (2-373)
      • expression tag (1)
    Domains in SCOPe 2.06: d3sjnb1, d3sjnb2, d3sjnb3
  • Heterogens: MG, UNL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sjnA (A:)
    mvlkitdievlhlrvpamdadcewgedavivkvhtdkgivgvgeadssplvvqacieapq
    tnfycnglkrlligenaleierlwnkmywgsnymgrrgagihaisaidialwdiagqfyg
    vpvhtllggkyrdkircygtfipadkpednvaivqglkdqgfssikfgggvmgddpdtdy
    aivkavreaagpemevqidlaskwhtcghsammakrleefnlnwieepvladslisyekl
    srqvsqkiaggeslttryefqefitksnadivqpditrcggitemkkiydiaqmngtqli
    phgfstgillhasvhflaaceqgtlmefsqsssplftslvknqlqfdngfvavsdapglg
    ieldeeliakyrvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sjnA (A:)
    vlkitdievlhlrvpamdadcewgedavivkvhtdkgivgvgeadssplvvqacieapqt
    nfycnglkrlligenaleierlwnkmywgsnymgrrgagihaisaidialwdiagqfygv
    pvhtllggkyrdkircygtfipadkpednvaivqglkdqgfssikfgggvmgddpdtdya
    ivkavreaagpemevqidlaskwhtcghsammakrleefnlnwieepvladslisyekls
    rqvsqkiaggeslttryefqefitksnadivqpditrcggitemkkiydiaqmngtqlip
    hgfstgillhasvhflaaceqgtlmefsqsssplftslvknqlqfdngfvavsdapglgi
    eldeeliakyrvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sjnB (B:)
    mvlkitdievlhlrvpamdadcewgedavivkvhtdkgivgvgeadssplvvqacieapq
    tnfycnglkrlligenaleierlwnkmywgsnymgrrgagihaisaidialwdiagqfyg
    vpvhtllggkyrdkircygtfipadkpednvaivqglkdqgfssikfgggvmgddpdtdy
    aivkavreaagpemevqidlaskwhtcghsammakrleefnlnwieepvladslisyekl
    srqvsqkiaggeslttryefqefitksnadivqpditrcggitemkkiydiaqmngtqli
    phgfstgillhasvhflaaceqgtlmefsqsssplftslvknqlqfdngfvavsdapglg
    ieldeeliakyrvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sjnB (B:)
    vlkitdievlhlrvpamdadcewgedavivkvhtdkgivgvgeadssplvvqacieapqt
    nfycnglkrlligenaleierlwnkmywgsnymgrrgagihaisaidialwdiagqfygv
    pvhtllggkyrdkircygtfipadkpednvaivqglkdqgfssikfgggvmgddpdtdya
    ivkavreaagpemevqidlaskwhtcghsammakrleefnlnwieepvladslisyekls
    rqvsqkiaggeslttryefqefitksnadivqpditrcggitemkkiydiaqmngtqlip
    hgfstgillhasvhflaaceqgtlmefsqsssplftslvknqlqfdngfvavsdapglgi
    eldeeliakyrvn