PDB entry 3sgd

View 3sgd on RCSB PDB site
Description: Crystal structure of the mouse mAb 17.2
Class: immune system
Keywords: immunoglobulin fold, Antibody, Antigen binding, IMMUNE SYSTEM
Deposited on 2011-06-14, released 2011-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.176
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SGD (0-216)
  • Chain 'I':
    Compound: light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SGD (0-End)
    Domains in SCOPe 2.07: d3sgdi1, d3sgdi2
  • Chain 'J':
    Compound: heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SGD (0-End)
  • Chain 'L':
    Compound: light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3SGD (0-End)
    Domains in SCOPe 2.07: d3sgdl1, d3sgdl2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3sgdI (I:)
    dvvmtqtpltlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgshfpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sgdI (I:)
    dvvmtqtpltlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgshfpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'J':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3sgdL (L:)
    dvvmtqtpltlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgshfpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sgdL (L:)
    dvvmtqtpltlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgshfpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne