PDB entry 3sfv

View 3sfv on RCSB PDB site
Description: Crystal structure of the GDP-bound Rab1a S25N mutant in complex with the coiled-coil domain of LidA from Legionella pneumophila
Class: protein transport/protein binding
Keywords: LidA-Rab Complex, Coiled-coil domain, Type IV effector protein from legionella, GDP Binding, protein transport-protein binding complex
Deposited on 2011-06-14, released 2012-04-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.193
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-1A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62820 (5-180)
      • expression tag (2-4)
      • engineered mutation (29)
    Domains in SCOPe 2.06: d3sfva1, d3sfva2
  • Chain 'B':
    Compound: LidA protein, substrate of the Dot/Icm system
    Species: Legionella pneumophila [TaxId:400673]
    Gene: lidA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5IFX1 (Start-335)
      • expression tag (336-342)
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sfvA (A:)
    gplgsmssmnpeydylfkllligdsgvgknclllrfaddtytesyistigvdfkirtiel
    dgktiklqiwdtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryase
    nvnkllvgnkcdlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkr
    m
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sfvA (A:)
    lgsmssmnpeydylfkllligdsgvgknclllrfaddtytesyistigvdfkirtieldg
    ktiklqiwdtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenv
    nkllvgnkcdlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrm
    

  • Chain 'B':
    No sequence available.