PDB entry 3sf6

View 3sf6 on RCSB PDB site
Description: Crystal structure of Glutaryl-CoA dehydrogenase from Mycobacterium smegmatis
Class: oxidoreductase
Keywords: SSGCID, NIH, NIAID, SBRI, UW, Emerald BioStructures, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, OXIDOREDUCTASE
Deposited on 2011-06-12, released 2011-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: MSMEG_2466
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3sf6a1, d3sf6a2
  • Heterogens: FDA, UNL, EDO, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sf6A (A:)
    gpgsmtnsavaqprsqrrgaddliginavlsaeereirdtvrsvvqrrikphiaswyedg
    elparelavelgelgllgmhlkgygcagmsavayglacleleagdsgirslvsvqgslam
    yaihafgsdeqkdqwlpdmasghrigcfgltepdhgsdpagmrtratrsgddwiltgtkm
    witngsvadvavvwartdegirgfvvptdtpgftantikskmslrasvtselvldgvrlp
    dsarlpgatslgaplrclnearfgivfgalgaardcletalayacsreqfdrpiggfqlt
    qqkladmtleygkgfllalhlgrqkdagelapeqvslgklnnvreaieiartartvlgas
    gitgeypvmrhannlesvltyegtsemhtliigqaltgvgafr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sf6A (A:)
    rrgaddliginavlsaeereirdtvrsvvqrrikphiaswyedgelparelavelgelgl
    lgmhlkgygcagmsavayglacleleagdsgirslvsvqgslamyaihafgsdeqkdqwl
    pdmasghrigcfgltepdhgsdpagmrtratrsgddwiltgtkmwitngsvadvavvwar
    tdegirgfvvptdtpgftantikskmslrasvtselvldgvrlpdsarlpgatslgaplr
    clnearfgivfgalgaardcletalayacsreqfdrpiggfqltqqkladmtleygkgfl
    lalhlgrqkdagelapeqvslgklnnvreaieiartartvlgasgitgeypvmrhannle
    svltyegtsemhtliigqaltgvgafr