PDB entry 3sdp

View 3sdp on RCSB PDB site
Description: the 2.1 angstroms resolution structure of iron superoxide dismutase from pseudomonas ovalis
Class: oxidoreductase (superoxide acceptor)
Keywords: oxidoreductase (superoxide acceptor)
Deposited on 1991-05-06, released 1993-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.232
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: iron superoxide dismutase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09223
      • conflict (84)
    Domains in SCOPe 2.07: d3sdpa1, d3sdpa2
  • Chain 'B':
    Compound: iron superoxide dismutase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09223
      • conflict (84)
    Domains in SCOPe 2.07: d3sdpb1, d3sdpb2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sdpA (A:)
    afelpplpyahdalqphisketleyhhdkhhntyvvnlnnlvpgtpefegktleeivkss
    sggifnnaaqvwnhtfywnclspdaggqptgaladainaafgsfdkfkeeftktsvgtfg
    sgwawlvkadgslalcstigagapltsgdtplltcdvwehayyidyrnlrpkyveafwnl
    vnwafvaeegktfka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sdpA (A:)
    pplpyahdalqphisketleyhhdkhhntyvvnlnnlvpgtpefegktleeivksssggi
    fnnaaqvwnhtfywnclspdaggqptgaladainaafgsfdkfkeeftktsvgtfgsgwa
    wlvkadgslalcstigagapltsgdtplltcdvwehayyidyrnlrpkyveafwnlvnwa
    fvaeeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sdpB (B:)
    afelpplpyahdalqphisketleyhhdkhhntyvvnlnnlvpgtpefegktleeivkss
    sggifnnaaqvwnhtfywnclspdaggqptgaladainaafgsfdkfkeeftktsvgtfg
    sgwawlvkadgslalcstigagapltsgdtplltcdvwehayyidyrnlrpkyveafwnl
    vnwafvaeegktfka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sdpB (B:)
    pplpyahdalqphisketleyhhdkhhntyvvnlnnlvpgtpefegktleeivksssggi
    fnnaaqvwnhtfywnclspdaggqptgaladainaafgsfdkfkeeftktsvgtfgsgwa
    wlvkadgslalcstigagapltsgdtplltcdvwehayyidyrnlrpkyveafwnlvnwa
    fvaeeg