PDB entry 3scp

View 3scp on RCSB PDB site
Description: Crystal Structure of Rice BGlu1 E386A Mutant
Class: hydrolase
Keywords: beta-alpha-barrels, glycosynthase, oligosaccharide synthesis, transglucosylation, hydrolase
Deposited on 2011-06-08, released 2012-06-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.176
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase 7
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: BGLU1, BGLU7, LOC_Os03g49600, Os03g0703000, Os3BGlu7, OSJNBa0004L11.16
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q75I93 (Start-480)
      • see remark 999 (28)
      • engineered mutation (390)
    Domains in SCOPe 2.06: d3scpa_
  • Chain 'B':
    Compound: Beta-glucosidase 7
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: BGLU1, BGLU7, LOC_Os03g49600, Os03g0703000, Os3BGlu7, OSJNBa0004L11.16
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q75I93 (Start-480)
      • see remark 999 (28)
      • engineered mutation (390)
    Domains in SCOPe 2.06: d3scpb_
  • Heterogens: ZN, SO4, MES, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3scpA (A:)
    amadvvpkpnwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnva
    gnqngdvatdqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlin
    yllqkgitpyvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfn
    eprivallgydqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqq
    gkvgivldfnwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkf
    tpeqarlvkgsadyiginqytasymkgqqlmqqtptsysadwqvtyvfakngkpigpqan
    snwlyivpwgmygcvnyikqkygnptvvitangmdqpanlsrdqylrdttrvhfyrsylt
    qlkkaideganvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlk
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3scpA (A:)
    nwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnvagnqngdvat
    dqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlinyllqkgitp
    yvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfneprivallg
    ydqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqqgkvgivldf
    nwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkftpeqarlvk
    gsadyiginqytasymkgqqlmqqtptsysadwqvtyvfakngkpigpqansnwlyivpw
    gmygcvnyikqkygnptvvitangmdqpanlsrdqylrdttrvhfyrsyltqlkkaideg
    anvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlkh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3scpB (B:)
    amadvvpkpnwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnva
    gnqngdvatdqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlin
    yllqkgitpyvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfn
    eprivallgydqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqq
    gkvgivldfnwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkf
    tpeqarlvkgsadyiginqytasymkgqqlmqqtptsysadwqvtyvfakngkpigpqan
    snwlyivpwgmygcvnyikqkygnptvvitangmdqpanlsrdqylrdttrvhfyrsylt
    qlkkaideganvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlk
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3scpB (B:)
    nwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnvagnqngdvat
    dqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlinyllqkgitp
    yvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfneprivallg
    ydqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqqgkvgivldf
    nwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkftpeqarlvk
    gsadyiginqytasymkgqqlmqqtptsysadwqvtyvfakngkpigpqansnwlyivpw
    gmygcvnyikqkygnptvvitangmdqpanlsrdqylrdttrvhfyrsyltqlkkaideg
    anvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlkh