PDB entry 3sbf

View 3sbf on RCSB PDB site
Description: Crystal structure of the mutant P311A of enolase superfamily member from VIBRIONALES BACTERIUM complexed with Mg and D-Arabinonate
Class: isomerase
Keywords: enolase fold, acid sugar dehydratase, D-Araninonate, ISOMERASE
Deposited on 2011-06-04, released 2012-06-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.181
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase / muconate lactonizing enzyme
    Species: Vibrionales bacterium SWAT-3 [TaxId:391574]
    Gene: VSWAT3_13707
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5KUH4 (Start-400)
      • engineered mutation (310)
    Domains in SCOPe 2.06: d3sbfa1, d3sbfa2
  • Chain 'B':
    Compound: Mandelate racemase / muconate lactonizing enzyme
    Species: Vibrionales bacterium SWAT-3 [TaxId:391574]
    Gene: VSWAT3_13707
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5KUH4 (3-400)
      • engineered mutation (310)
    Domains in SCOPe 2.06: d3sbfb1, d3sbfb2
  • Chain 'C':
    Compound: Mandelate racemase / muconate lactonizing enzyme
    Species: Vibrionales bacterium SWAT-3 [TaxId:391574]
    Gene: VSWAT3_13707
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5KUH4 (Start-400)
      • engineered mutation (310)
    Domains in SCOPe 2.06: d3sbfc1, d3sbfc2
  • Chain 'D':
    Compound: Mandelate racemase / muconate lactonizing enzyme
    Species: Vibrionales bacterium SWAT-3 [TaxId:391574]
    Gene: VSWAT3_13707
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5KUH4 (3-400)
      • expression tag (2)
      • engineered mutation (310)
    Domains in SCOPe 2.06: d3sbfd1, d3sbfd2, d3sbfd3
  • Heterogens: MG, EPE, D8T, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sbfA (A:)
    mslketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpi
    ligknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksr
    daipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsyydq
    dqymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnq
    tewldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcq
    nfgvriawhcapdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingyly
    aseiagigveidreaaaefpvmyrphewtqsrlpdgaihtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sbfA (A:)
    etiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpiligk
    nanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksrdaip
    vythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsyydqdqym
    dntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnqtewl
    dnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcqnfgv
    riawhcapdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingylyasei
    agigveidreaaaefpvmyrphewtqsrlpdgaihtp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sbfB (B:)
    mslketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpi
    ligknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksr
    daipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsyydq
    dqymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnq
    tewldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcq
    nfgvriawhcapdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingyly
    aseiagigveidreaaaefpvmyrphewtqsrlpdgaihtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sbfB (B:)
    ketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpilig
    knanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksrdai
    pvythatsdtmegiydlvegflekgykhircqlglhttqnptegsyydqdqymdntltmf
    kslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnqtewldnirsqs
    svslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcqnfgvriawhca
    pdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingylyaseiagigvei
    dreaaaefpvmyrphewtqsrlpdgaihtp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3sbfC (C:)
    mslketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpi
    ligknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksr
    daipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsyydq
    dqymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnq
    tewldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcq
    nfgvriawhcapdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingyly
    aseiagigveidreaaaefpvmyrphewtqsrlpdgaihtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sbfC (C:)
    etiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpiligk
    nanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksrdaip
    vythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsyydqdqym
    dntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnqtewl
    dnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcqnfgv
    riawhcapdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingylyasei
    agigveidreaaaefpvmyrphewtqsrlpdgaihtp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3sbfD (D:)
    mslketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpi
    ligknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksr
    daipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsyydq
    dqymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnq
    tewldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcq
    nfgvriawhcapdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingyly
    aseiagigveidreaaaefpvmyrphewtqsrlpdgaihtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sbfD (D:)
    lketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpili
    gknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksrda
    ipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsyydqdq
    ymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnqte
    wldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcqnf
    gvriawhcapdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingylyas
    eiagigveidreaaaefpvmyrphewtqsrlpdgaihtp