PDB entry 3sbd

View 3sbd on RCSB PDB site
Description: Crystal structure of RAC1 P29S mutant
Class: hydrolase
Keywords: Rossmann fold, GTPASE, GTP Binding, HYDROLASE
Deposited on 2011-06-03, released 2012-07-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.24
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC1, TC25, MIG5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63000 (11-186)
      • expression tag (10)
      • engineered mutation (38)
    Domains in SCOPe 2.06: d3sbda1, d3sbda2
  • Chain 'B':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC1, TC25, MIG5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63000 (11-186)
      • engineered mutation (38)
    Domains in SCOPe 2.06: d3sbdb_
  • Heterogens: GNP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sbdA (A:)
    gshmenlyfqgqaikcvvvgdgavgktcllisyttnafsgeyiptvfdnysanvmvdgkp
    vnlglwdtagqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpi
    ilvgtkldlrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfd
    eairavl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sbdA (A:)
    gqaikcvvvgdgavgktcllisyttnafsgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sbdB (B:)
    gshmenlyfqgqaikcvvvgdgavgktcllisyttnafsgeyiptvfdnysanvmvdgkp
    vnlglwdtagqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpi
    ilvgtkldlrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfd
    eairavl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sbdB (B:)
    qaikcvvvgdgavgktcllisyttnafsgeyiptvfdnysanvmvdgkpvnlglwdtagq
    edydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrd
    dkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavl