PDB entry 3saa
View 3saa on RCSB PDB site
Description: Crystal structure of Wild-type HIV-1 protease in complex With AF77
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, drug resistance, drug design, protease inhibitors, AIDS, aspartyl protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2011-06-02, released
2012-06-06
The last revision prior to the SCOPe 2.06 freeze date was dated
2012-06-06, with a file datestamp of
2012-06-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.176
AEROSPACI score: 0.48
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: Gag-Pol, pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3saaa_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: Gag-Pol, pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3saab_ - Heterogens: PO4, 77F, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3saaA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3saaB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf