PDB entry 3s96

View 3s96 on RCSB PDB site
Description: Crystal structure of 3B5H10
Class: immune system
Keywords: FAB, huntingtin, immune system
Deposited on 2011-05-31, released 2012-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-08, with a file datestamp of 2012-08-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3B5H10 FAB heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3S96 (0-219)
  • Chain 'B':
    Compound: 3B5H10 FAB light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3S96 (0-217)
    Domains in SCOPe 2.07: d3s96b1, d3s96b2
  • Chain 'C':
    Compound: 3B5H10 FAB heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3S96 (0-219)
  • Chain 'D':
    Compound: 3B5H10 FAB light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3S96 (Start-217)
    Domains in SCOPe 2.07: d3s96d1, d3s96d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3s96B (B:)
    qlvltqsssasfslgasakltctlnsqhstytiewyqqqplkppkyvmelkkdgshstgd
    gipdrfsgsssgadrylsisniqpedeaiyicgvgdtikeqfvyvfgggtkvtvlgqpks
    tptltvfppsseelkenkatlvclisnfspsgvtvawkangtpitqgvdtsnptkegnkf
    massflhltsdqwrshnsftcqvthegdtvekslspae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s96B (B:)
    qlvltqsssasfslgasakltctlnsqhstytiewyqqqplkppkyvmelkkdgshstgd
    gipdrfsgsssgadrylsisniqpedeaiyicgvgdtikeqfvyvfgggtkvtvlgqpks
    tptltvfppsseelkenkatlvclisnfspsgvtvawkangtpikfmassflhltsdqwr
    shnsftcqvthegdtvekslspae
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3s96D (D:)
    qlvltqsssasfslgasakltctlnsqhstytiewyqqqplkppkyvmelkkdgshstgd
    gipdrfsgsssgadrylsisniqpedeaiyicgvgdtikeqfvyvfgggtkvtvlgqpks
    tptltvfppsseelkenkatlvclisnfspsgvtvawkangtpitqgvdtsnptkegnkf
    massflhltsdqwrshnsftcqvthegdtvekslspae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s96D (D:)
    lvltqsssasfslgasakltctlnsqhstytiewyqqqplkppkyvmelkkdgshstgdg
    ipdrfsgsssgadrylsisniqpedeaiyicgvgdtikeqfvyvfgggtkvtvlgqpkst
    ptltvfppsseelkenkatlvclisnfspsgvtvawkangtpikfmassflhltsdqwrs
    hnsftcqvthegdtvekslspae