PDB entry 3s92

View 3s92 on RCSB PDB site
Description: Crystal Structure of the second bromodomain of human BRD3 in complex with the inhibitor JQ1
Class: unknown function
Keywords: BRD3, Bromodomain containing protein 3, ORFX, RING3 like gene, RING3L, JQ1, Structural Genomics, Structural Genomics Consortium, SGC, UNKNOWN FUNCTION
Deposited on 2011-05-31, released 2011-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: 0.134
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD3, KIAA0043, RING3L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3s92a_
  • Heterogens: JQ1, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3s92A (A:)
    smgklsehlrycdsilremlskkhaayawpfykpvdaealelhdyhdiikhpmdlstvkr
    kmdgreypdaqgfaadvrlmfsncykynppdhevvamarklqdvfemrfakmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s92A (A:)
    klsehlrycdsilremlskkhaayawpfykpvdaealelhdyhdiikhpmdlstvkrkmd
    greypdaqgfaadvrlmfsncykynppdhevvamarklqdvfemrfakmp