PDB entry 3s8y

View 3s8y on RCSB PDB site
Description: Bromide soaked structure of an esterase from the oil-degrading bacterium Oleispira antarctica
Class: hydrolase
Keywords: Rossmann fold, HYDROLASE
Deposited on 2011-05-31, released 2011-06-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-07-18, with a file datestamp of 2012-07-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.156
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Esterase APC40077
    Species: Oleispira antarctica [TaxId:188908]
    Gene: olei01171
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3s8ya_
  • Heterogens: BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3s8yA (A:)
    gmsienlssnksfggwhkqyshvsntlncamrfaiylppqastgakvpvlywlsgltcsd
    enfmqkagaqrlaaelgiaivapdtsprgegvaddegydlgqgagfyvnatqapwnrhyq
    mydyvvnelpeliesmfpvsdkraiaghsmgghgaltialrnperyqsvsafspinnpvn
    cpwgqkaftaylgkdtdtwreydasllmraakqyvpalvdqgeadnflaeqlkpevleaa
    assnnyplelrshegydhsyyfiasfiedhlrfhsnylna
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s8yA (A:)
    sienlssnksfggwhkqyshvsntlncamrfaiylppqastgakvpvlywlsgltcsden
    fmqkagaqrlaaelgiaivapdtsprgegvaddegydlgqgagfyvnatqapwnrhyqmy
    dyvvnelpeliesmfpvsdkraiaghsmgghgaltialrnperyqsvsafspinnpvncp
    wgqkaftaylgkdtdtwreydasllmraakqyvpalvdqgeadnflaeqlkpevleaaas
    snnyplelrshegydhsyyfiasfiedhlrfhsnyln