PDB entry 3s8o

View 3s8o on RCSB PDB site
Description: Crystal Structure of the Grb2 SH2 Domain in Complex with a pYXN-Derived Tripeptide
Class: signaling protein/antagonist
Keywords: Grb2 SH2 domain, phosphotyrosine-containing tripeptide, SIGNALING PROTEIN-ANTAGONIST complex
Deposited on 2011-05-29, released 2011-11-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.153
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2, ASH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3s8oa_
  • Chain 'B':
    Compound: pYAc6cN
    Database cross-references and differences (RAF-indexed):
    • PDB 3S8O
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3s8oA (A:)
iemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlr
dgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqahhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3s8oA (A:)
emkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrd
gagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqv

  • Chain 'B':
    No sequence available.