PDB entry 3s8l
View 3s8l on RCSB PDB site
Description: Protein-Ligand Interactions: Thermodynamic Effects Associated with Increasing Hydrophobic Surface Area
Class: signaling protein/antagonist
Keywords: Grb2 SH2 domain, phosphotyrosine-containing tripeptide, SIGNALING PROTEIN-ANTAGONIST complex
Deposited on
2011-05-29, released
2011-11-02
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-12-07, with a file datestamp of
2011-12-02.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.199
AEROSPACI score: 0.54
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Growth factor receptor-bound protein 2
Species: Homo sapiens [TaxId:9606]
Gene: GRB2, ASH
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3s8la_ - Chain 'B':
Compound: pYAc4cN
Database cross-references and differences (RAF-indexed):
- Heterogens: CL, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3s8lA (A:)
iemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlr
dgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqahhhhhh
Sequence, based on observed residues (ATOM records): (download)
>3s8lA (A:)
emkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrd
gagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqv
- Chain 'B':
No sequence available.