PDB entry 3s8g

View 3s8g on RCSB PDB site
Description: 1.8 A structure of ba3 cytochrome c oxidase mutant (A120F) from Thermus thermophilus in lipid environment
Class: oxidoreductase
Keywords: Complex IV, Electron transport, Proton pump, Oxidoreductase, Respiratory chain, Membrane protein, Lipid cubic phase, monoolein, peroxide
Deposited on 2011-05-27, released 2011-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaA, TTHA1135
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJ79 (Start-568)
      • conflict (126)
    Domains in SCOPe 2.07: d3s8ga_
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaB, cbac, ctaC, TTHA1134
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3s8gb1, d3s8gb2
  • Chain 'C':
    Compound: Cytochrome c oxidase polypeptide 2A
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaD, TTHA1133
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3s8gc_
  • Heterogens: HEM, HAS, CU, PER, OLC, CUA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3s8gA (A:)
    mhhhhhhhavraseisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdayp
    llkrllpfvqsyyqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwma
    figlvvfalpllaneatvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaa
    npgkvtplvtymavvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtgh
    pivyfwllpayaiiytilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidpt
    wkmihsvltlfvavpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgl
    lgfipggaggivnasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpi
    sdaqrrlglavvwlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvla
    givllvalllfiyglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfav
    aailvvlaygptlvqlfghlnpvpgwrlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s8gA (A:)
    srvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqg
    ltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvfalpllane
    atvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavv
    fwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiy
    tilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavp
    slmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnas
    ftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlw
    flgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiygl
    fsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvq
    lfghlnpvpgwrlw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3s8gB (B:)
    mvdehkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrq
    egpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhveg
    tninvevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s8gB (B:)
    dehkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrqeg
    pwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhvegtn
    invevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3s8gC (C:)
    meekpkgalavilvltltilvfwlgvyavffarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s8gC (C:)
    kpkgalavilvltltilvfwlgvyavffarg