PDB entry 3s7g

View 3s7g on RCSB PDB site
Description: Aglycosylated human igg1 fc fragment
Class: immune system
Keywords: AGLYCOSYLATED, FC FRAGMENT, ANTIBODY, IMMUNE SYSTEM, immunoglobulin
Deposited on 2011-05-26, released 2012-05-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 3.13 Å
R-factor: 0.262
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1, IGHM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3s7ga1, d3s7ga2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1, IGHM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3s7gb1, d3s7gb2
  • Chain 'C':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1, IGHM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3s7gc1, d3s7gc2
  • Chain 'D':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1, IGHM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3s7gd1, d3s7gd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3s7gA (A:)
    dkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvd
    gvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskak
    gqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvlds
    dgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s7gA (A:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3s7gB (B:)
    dkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvd
    gvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskak
    gqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvlds
    dgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s7gB (B:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqksls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3s7gC (C:)
    dkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvd
    gvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskak
    gqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvlds
    dgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s7gC (C:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3s7gD (D:)
    dkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvd
    gvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskak
    gqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvlds
    dgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s7gD (D:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn
    styrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrde
    ltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsls