PDB entry 3s6n

View 3s6n on RCSB PDB site
Description: Crystal Structure of the Gemin2-binding domain of SMN, Gemin2 in Complex with SmD1/D2/F/E/G from Human
Class: splicing
Keywords: SMN complex, SMN-Gemin2 complex, U-rich snRNA, Sm fold, Sm core, snRNPs, snRNP Biogenesis, pre-mRNA SPLICING, SPLICEOSOME, HETEROMERIC HEPTAMERIC RING, protein complex, Splicing, mRNA, helix protein, Survival of Motor Neuron, Splicing factor, RNA binding
Deposited on 2011-05-25, released 2011-08-17
Made obsolete by 5xjl on 2018-05-02

The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-17, with a file datestamp of 2011-08-12.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.258
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '2':
    Compound: Survival of motor neuron protein-interacting protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SIP1, GEMIN2
    Database cross-references and differences (RAF-indexed):
  • Chain 'A':
    Compound: Small nuclear ribonucleoprotein Sm D1
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3s6na_
  • Chain 'B':
    Compound: Small nuclear ribonucleoprotein Sm D2
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPD2, SNRPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3s6nb_
  • Chain 'E':
    Compound: Small nuclear ribonucleoprotein E
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPE
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Small nuclear ribonucleoprotein F
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPF, PBSCF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3s6nf_
  • Chain 'G':
    Compound: Small nuclear ribonucleoprotein G
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPG, PBSCG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3s6ng_
  • Chain 'M':
    Compound: Survival motor neuron protein
    Species: Homo sapiens [TaxId:9606]
    Gene: SMN1, SMN, SMNT, SMN2, SMNC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain '2':
    No sequence available.

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3s6nA (A:)
    mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
    rgnniryfilpdslpldtllvdvepkvkskkreavagrgrgrgrgrgrgrgrgrggprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s6nA (A:)
    mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
    rgnniryfilpdslpldtllv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3s6nB (B:)
    msllnkpksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafd
    rhcnmvlenvkemwtevpksgkgkkkskpvnkdryiskmflrgdsvivvlrnpliagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s6nB (B:)
    efntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemwtevnkdry
    iskmflrgdsvivvlrnplia
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3s6nF (F:)
    mslplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlg
    evlircnnvlyirgveeeeedgemre
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s6nF (F:)
    lplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlgev
    lircnnvlyirgve
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3s6nG (G:)
    mskahppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmv
    virgnsiimlealerv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s6nG (G:)
    dkklslklnggrhvqgilrgfdpfmnlvidecvematsnigmvvirgnsiimlea
    

  • Chain 'M':
    No sequence available.