PDB entry 3s6c

View 3s6c on RCSB PDB site
Description: Structure of human CD1e
Class: immune system, lipid binding protein
Keywords: MHC, IMMUNOGLOBULIN DOMAIN, IMMUNE SYSTEM, ANTIGEN PRESENTATION, N-glycosylation, intracellular, LIPID BINDING PROTEIN
Deposited on 2011-05-25, released 2011-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2-microglobulin, T-cell surface glycoprotein CD1e, membrane-associated
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CD1E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (0-98)
      • linker (99)
    • Uniprot P15812 (Start-385)
      • see remark 999 (188)
      • expression tag (386-390)
    Domains in SCOPe 2.07: d3s6ca1, d3s6ca2, d3s6ca3, d3s6ca4
  • Heterogens: NAG, FUC, GOL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3s6cA (A:)
    iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw
    sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdmddddkgssssddddkeeqlsf
    rmlqtssfanhswahsegsgwlgdlqthgwdtvlgtirflkpwshgnfskqelknlqslf
    qlyfhsfirivqasagqfqleypfeiqilagcrmnapqiflnmayqgsdflsfqgiswep
    spgagiraqnickvlnryldikeilqsllghtcprflaglmeageselkrkvkpeawlsc
    gpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqrgtqrgdvlpnadetwylratldvaa
    geaaglscrvkhsslgghdliihwggenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s6cA (A:)
    iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw
    sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdmdqlsfrmlqtssfanhswahs
    egsgwlgdlqthgwdtvlgtirflkpwshgnfskqelknlqslfqlyfhsfirivqasag
    qfqleypfeiqilagcrmnapqiflnmayqgsdflsfswepspgagiraqnickvlnryl
    dikeilqsllghtcprflaglmeageselkrkvkpeawlscgpspgpgrlqlvchvsgfy
    pkpvwvmwmrgeqeqrgtqrgdvlpnadetwylratldvaageaaglscrvkhsslgghd
    liihwggenlyf