PDB entry 3s69

View 3s69 on RCSB PDB site
Description: Crystal structure of saxthrombin
Class: hydrolase
Keywords: Beta-barrel, serine enzymes, fibrinogen binding, glycosylation, HYDROLASE
Deposited on 2011-05-25, released 2012-05-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: 0.19
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thrombin-like enzyme defibrase
    Species: Gloydius saxatilis [TaxId:92067]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3s69a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3s69A (A:)
viggdecninehrslvaffnstgffcsgtlineewvltaahcdntnfqmklgvhskkvln
edeqtrnpkekficpnkkndevldkdimlikldsrvsnsehivplslpssppsvgsvchi
mgwgsitpikvtypdvpycayinllddavcqagypellteyrtlcagileggkdtcggds
ggplicngqfqgivsfgahpcgqglkpgvytkvfdynhwiqsiiagnttvtcpq