PDB entry 3s4x

View 3s4x on RCSB PDB site
Description: Crystal structure of the Asn152Gly mutant of P99 beta-lactamase
Class: hydrolase
Keywords: hydrolase, cephalosporinase
Deposited on 2011-05-20, released 2012-08-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.178
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: AMPC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05364 (0-360)
      • engineered mutation (15)
      • engineered mutation (87)
      • engineered mutation (151)
      • engineered mutation (298)
      • expression tag (361-366)
    Domains in SCOPe 2.05: d3s4xa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3s4xA (A:)
    tpvsekqlaevvantvtplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlf
    elgsisktftgvlggdaiargeislddpvtrywpqltgkqwqgirmldlatytagglplq
    vpdevtdnasllrfyqnwqpqwkpgttrlyagasiglfgalavkpsgmpyeqamttrvlk
    plkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmap
    envadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvve
    vnppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal
    qhhhhhh