PDB entry 3s37

View 3s37 on RCSB PDB site
Description: Structural basis for the function of two anti-VEGF receptor antibodies
Class: IMMUNE SYSTEM/Transferase
Keywords: antibody, KDR, VEGF receptor, cancer, IMMUNE SYSTEM-Transferase complex
Deposited on 2011-05-17, released 2011-08-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.284
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 1121B Fab heavy chain
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3S37
  • Chain 'L':
    Compound: 1121B Fab light chain
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3S37
    Domains in SCOPe 2.05: d3s37l1, d3s37l2
  • Chain 'X':
    Compound: Vascular endothelial growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FLK1, KDR
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3s37L (L:)
    diqmtqspssvsasigdrvtitcrasqgidnwlgwyqqkpgkapklliydasnldtgvps
    rfsgsgsgtyftltisslqaedfavyfcqqakafpptfgggtkvdikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s37L (L:)
    iqmtqspssvsasigdrvtitcrasqgidnwlgwyqqkpgkapklliydasnldtgvpsr
    fsgsgsgtyftltisslqaedfavyfcqqakafpptfgggtkvdikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'X':
    No sequence available.