PDB entry 3s1b

View 3s1b on RCSB PDB site
Description: The Development of Peptide-based Tools for the Analysis of Angiogenesis
Class: signaling protein
Keywords: VEGF, cystine knot, mini-Z, SIGNALING PROTEIN
Deposited on 2011-05-14, released 2011-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-17, with a file datestamp of 2011-08-12.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.222
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mini-Z
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3S1B (0-33)
  • Chain 'V':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Gene: VEGF, VEGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3s1bv_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3s1bV (V:)
    hevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpt
    eesnitmqimrikphqgqhigemsflqhnkcecrpk