PDB entry 3s0z

View 3s0z on RCSB PDB site
Description: Crystal structure of New Delhi Metallo-beta-lactamase (NDM-1)
Class: hydrolase
Keywords: New Delhi metallo-beta-lactamase 1, NDM-1, drug resistant, drug discovery, HYDROLASE
Deposited on 2011-05-13, released 2011-06-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.236
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metallo-beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3s0za_
  • Chain 'B':
    Compound: metallo-beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3s0zb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3s0zA (A:)
    gdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqilnwik
    qeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltfaan
    gwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlgdadt
    ehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s0zA (A:)
    gdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqilnwik
    qeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltfaan
    patapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlgdadtehya
    asarafgaafpkasmivmshsapdsraaithtarmadklr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3s0zB (B:)
    gdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqilnwik
    qeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltfaan
    gwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlgdadt
    ehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s0zB (B:)
    gdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqilnwik
    qeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltfaan
    patapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlgdadtehya
    asarafgaafpkasmivmshsapdsraaithtarmadklr