PDB entry 3rzw

View 3rzw on RCSB PDB site
Description: Crystal Structure of the Monobody ySMB-9 bound to human SUMO1
Class: protein binding
Keywords: Beta Sandwich, Beta Grasp, Antibody mimic, Engineered Binding Protein, Post-translational Modification, PROTEIN BINDING
Deposited on 2011-05-12, released 2011-12-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.189
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monobody ySMB-9
    Species: Homo sapiens [TaxId:9606]
    Gene: SUMO1, SMT3C, SMT3H3, UBL1, OK/SW-cl.43
    Database cross-references and differences (RAF-indexed):
    • PDB 3RZW (Start-94)
  • Chain 'B':
    Compound: Monobody ySMB-9
    Species: Homo sapiens [TaxId:9606]
    Gene: SUMO1, SMT3C, SMT3H3, UBL1, OK/SW-cl.43
    Database cross-references and differences (RAF-indexed):
    • PDB 3RZW (Start-94)
  • Chain 'C':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165
      • engineered mutation (53)
    Domains in SCOPe 2.01: d3rzwc_
  • Chain 'D':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165 (Start-98)
      • engineered mutation (53)
    Domains in SCOPe 2.01: d3rzwd_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >3rzwC (C:)
gsmsdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesyaqrqgvp
mnslrflfegqriadnhtpkelgmeeedvievyqeqtgg

    Sequence, based on observed residues (ATOM records): (download) 
    >3rzwC (C:)
eyiklkvigqdsseihfkvkmtthlkklkesyaqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeq

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >3rzwD (D:)
gsmsdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesyaqrqgvp
mnslrflfegqriadnhtpkelgmeeedvievyqeqtgg

    Sequence, based on observed residues (ATOM records): (download) 
    >3rzwD (D:)
eyiklkvigqdsseihfkvkmtthlkklkesyaqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqtgg