PDB entry 3rzv

View 3rzv on RCSB PDB site
Description: The Crystal Structure of a E280A Mutant of the Catalytic Domain of AMSH
Class: hydrolase
Keywords: Ubiquitin Hydrolase, STAM, Endosome-associated deubiquitinating enzyme, HYDROLASE
Deposited on 2011-05-12, released 2011-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.181
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stam-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: AMSH, STAMBP, STAMBP (AMSH)
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95630 (Start-210)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d3rzva_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rzvA (A:)
    gplgssdchttvrpakppvvdrslkpgalsnsesiptidglrhvvvpgrlcpqflqlasa
    ntargvatcgilcgklmrneftithvlipkqsagsdycnteneeelfliqdqqglitlgw
    ihthptqtaflssvdlhthcsyqmmlpesvaivcspkfqetgffkltdhgleeisscrqk
    gfhphskdpplfcscshvtvvdravtitdlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rzvA (A:)
    esiptidglrhvvvpgrlcpqflqlasantargvatcgilcgklmrneftithvlipkqs
    agsdycnteneeelfliqdqqglitlgwihthptqtaflssvdlhthcsyqmmlpesvai
    vcspkfqetgffkltdhgleeisscrqkgfhphskdpplfcscshvtvvdravtitdlr