PDB entry 3rzt

View 3rzt on RCSB PDB site
Description: Neutron structure of perdeuterated rubredoxin using rapid (14 hours) data
Class: electron transport
Keywords: Iron, metal-binding, transport, electron transport
Deposited on 2011-05-12, released 2011-12-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-01-04, with a file datestamp of 2011-12-30.
Experiment type: NEUT
Resolution: 1.75 Å
R-factor: 0.204
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: PF1282, rub
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3rzta_
  • Heterogens: FE, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3rztA (A:)
makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled

    Sequence, based on observed residues (ATOM records): (download) 
    >3rztA (A:)
akwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekl