PDB entry 3ry9

View 3ry9 on RCSB PDB site
Description: Crystal Structure of the Resurrected Ancestral Glucocorticoid Receptor 1 in complex with DOC
Class: steroid binding protein
Keywords: resurrected protein, steroid receptor, nuclear receptor, common ancestor, evolution, STEROID BINDING PROTEIN
Deposited on 2011-05-11, released 2011-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-06, with a file datestamp of 2011-07-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.181
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ancestral Glucocorticoid Receptor 1
    Species: artificial gene [TaxId:32630]
    Gene: resurrected gene
    Database cross-references and differences (RAF-indexed):
    • PDB 3RY9 (Start-249)
    Domains in SCOPe 2.06: d3ry9a_
  • Chain 'B':
    Compound: Ancestral Glucocorticoid Receptor 1
    Species: artificial gene [TaxId:32630]
    Gene: resurrected gene
    Database cross-references and differences (RAF-indexed):
    • PDB 3RY9 (0-End)
    Domains in SCOPe 2.06: d3ry9b_
  • Heterogens: GOL, 1CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ry9A (A:)
    aptmisileaiepdviyagydstlpdttnrllsslnrlggrqmisavkwakalpgfrnlh
    lddqmtllqyswmslmafslgwrsyqhtngnmlyfapdlifneermqqssmyelckgmhk
    islefvrlqvsyeeylcmkvllllstvpkdglksqaafdeirmsyikelgkaivkregns
    sqnwqrfyqltklldsmhdlvggllqfcfytfvesktlsvefpemlveiisnqlpkvmag
    makpllfhqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ry9A (A:)
    ptmisileaiepdviyagydstlpdttnrllsslnrlggrqmisavkwakalpgfrnlhl
    ddqmtllqyswmslmafslgwrsyqhtngnmlyfapdlifneermqqssmyelckgmhki
    slefvrlqvsyeeylcmkvllllstvpkdglksqaafdeirmsyikelgkaivkrnwqrf
    yqltklldsmhdlvggllqfcfytfvesktlsvefpemlveiisnqlpkvmagmakpllf
    hqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ry9B (B:)
    aptmisileaiepdviyagydstlpdttnrllsslnrlggrqmisavkwakalpgfrnlh
    lddqmtllqyswmslmafslgwrsyqhtngnmlyfapdlifneermqqssmyelckgmhk
    islefvrlqvsyeeylcmkvllllstvpkdglksqaafdeirmsyikelgkaivkregns
    sqnwqrfyqltklldsmhdlvggllqfcfytfvesktlsvefpemlveiisnqlpkvmag
    makpllfhqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ry9B (B:)
    aptmisileaiepdviyagydlpdttnrllsslnrlggrqmisavkwakalpgfrnlhld
    dqmtllqyswmslmafslgwrsyqhtngnmlyfapdlifneermqqssmyelckgmhkis
    lefvrlqvsyeeylcmkvllllstvpkdglksqaafdeirmsyikelgkaivkregnssq
    nwqrfyqltklldsmhdlvggllqfcfytfvesktlsvefpemlveiisnqlpkvmagma
    kpllfhq