PDB entry 3rws

View 3rws on RCSB PDB site
Description: Crystal Structure of Medicago truncatula Nodulin 13 (MtN13) in complex with trans-zeatin
Class: plant protein
Keywords: zeatin, cytokinin, hormone, lucerne, medicago, nodulin, nodulation, PLANT PROTEIN
Deposited on 2011-05-09, released 2012-05-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.198
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MtN13 protein
    Species: Medicago truncatula [TaxId:3880]
    Gene: MtN13
    Database cross-references and differences (RAF-indexed):
    • Uniprot P93330 (5-End)
      • expression tag (0-4)
    Domains in SCOPe 2.06: d3rwsa1, d3rwsa2
  • Heterogens: ZEA, MLI, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rwsA (A:)
    idpftmgvitseseyvsslsaeklyrgivedgniiypkalprfiekaetlegdggpgtik
    kltfvgdfgstkqhidmvdrencaytysvyegialsdqplekivfefklvptpeegcivk
    sttkyytkgddielskdyleagierfegftkavesfllanpdynkdsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rwsA (A:)
    idpftmgvitseseyvsslsaeklyrgivedgniiypkalprfiekaetlegdggpgtik
    kltfvgdfgstkqhidmvdrencaytysvyegialsdqplekivfefklvptpeegcivk
    sttkyytkgddielskdyleagierfegftkavesfllanpdy