PDB entry 3rwo

View 3rwo on RCSB PDB site
Description: Crystal structure of YPT32 in complex with GDP
Class: protein transport
Keywords: GTPASES, PROTEIN-GDP COMPLEX, EXOCYTOSIS, GOLGI APPARATUS, GTP-BINDING, LIPOPROTEIN, MEMBRANE, NUCLEOTIDE-BINDING, PRENYLATION, PROTEIN TRANSPORT, TRANSPORT, Ypt32, Rab GTPase, GDP, vesicle trafficking, Myo2p, effectors
Deposited on 2011-05-09, released 2011-10-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.169
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein YPT32/YPT11
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: YGL210W, YPT11, YPT32
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51996
      • engineered mutation (68)
    Domains in SCOPe 2.05: d3rwoa_
  • Chain 'B':
    Compound: GTP-binding protein YPT32/YPT11
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: YGL210W, YPT11, YPT32
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51996 (3-End)
      • engineered mutation (68)
    Domains in SCOPe 2.05: d3rwob_
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rwoA (A:)
    gamgydydylfkivligdsgvgksnllsrfttdefnieskstigvefatrtievenkkik
    aqiwdtagleryraitsayyrgavgalivydisksssyencnhwltelrenaddnvavgl
    ignksdlahlravptdeaknfamenqmlftetsalnsdnvdkafrelivaifqmvskhqv
    dlsgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rwoA (A:)
    dydylfkivligdsgvgksnllsrfttdefnieskstigvefatrtievenkkikaqiwd
    tagleryraitsayyrgavgalivydisksssyencnhwltelrenaddnvavglignks
    dlahlravptdeaknfamenqmlftetsalnsdnvdkafrelivaifqmv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rwoB (B:)
    gamgydydylfkivligdsgvgksnllsrfttdefnieskstigvefatrtievenkkik
    aqiwdtagleryraitsayyrgavgalivydisksssyencnhwltelrenaddnvavgl
    ignksdlahlravptdeaknfamenqmlftetsalnsdnvdkafrelivaifqmvskhqv
    dlsgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rwoB (B:)
    gydydylfkivligdsgvgksnllsrfttdefnieskstigvefatrtievenkkikaqi
    wdtagleryraitsayyrgavgalivydisksssyencnhwltelrenaddnvavglign
    ksdlahlravptdeaknfamenqmlftetsalnsdnvdkafrelivaifqmv