PDB entry 3rwm

View 3rwm on RCSB PDB site
Description: Crystal Structure of Ypt32 in Complex with GppNHp
Class: protein transport
Keywords: Ypt32, Rab GTPase, vesicle trafficking, Effectors, Myo2p, GppNHp, PROTEIN TRANSPORT
Deposited on 2011-05-09, released 2011-10-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: GTP-binding protein YPT32/YPT11
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: YGL210W, YPT11, YPT32
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51996 (3-End)
      • expression tag (2)
      • engineered mutation (68)
    Domains in SCOPe 2.06: d3rwmb1, d3rwmb2
  • Heterogens: GNP, MG, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rwmB (B:)
    gamgydydylfkivligdsgvgksnllsrfttdefnieskstigvefatrtievenkkik
    aqiwdtagleryraitsayyrgavgalivydisksssyencnhwltelrenaddnvavgl
    ignksdlahlravptdeaknfamenqmlftetsalnsdnvdkafrelivaifqmvskhqv
    dlsgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rwmB (B:)
    mgydydylfkivligdsgvgksnllsrfttdefnieskstigvefatrtievenkkikaq
    iwdtagleryraitsayyrgavgalivydisksssyencnhwltelrenaddnvavglig
    nksdlahlravptdeaknfamenqmlftetsalnsdnvdkafrelivaifqmvskhqvd