PDB entry 3rw7

View 3rw7 on RCSB PDB site
Description: Structure of N-terminal domain of nuclear RNA export factor TAP
Class: RNA binding protein, transport protein
Keywords: RNA recognition motif (RRM), leucine-rich repeat (LRR) motif, RNA BINDING PROTEIN, TRANSPORT PROTEIN
Deposited on 2011-05-07, released 2011-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-02, with a file datestamp of 2011-10-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.262
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nuclear RNA export factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NXF1, TAP, TAP (NXF1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rw7a1, d3rw7a2
  • Chain 'B':
    Compound: nuclear RNA export factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NXF1, TAP, TAP (NXF1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rw7b_
  • Chain 'C':
    Compound: nuclear RNA export factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NXF1, TAP, TAP (NXF1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rw7c1, d3rw7c2
  • Chain 'D':
    Compound: nuclear RNA export factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NXF1, TAP, TAP (NXF1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rw7d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rw7A (A:)
    vrrdrapperggagtsqdgtsknwfkitipygrkydkawllsmiqskcsvpftpiefhye
    ntraqffvedastasalkavnykildrenrrisiiinssapphtilnelkpeqveqlkli
    mskrydgsqqaldlkglrsdpdlvaqnidvvlnrrscmaatlriieenipellslnlsnn
    rlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwldgnslcdtfrdqs
    tyisairerfpkllrldghelpppiaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rw7A (A:)
    nwfkitipygrkydkawllsmiqskcsvpftpiefhyentraqffvedastasalkavny
    kildrenrrisiiinssapphtelkpeqveqlklimskrydgsqqaldlkglrsdpdlva
    qnidvvlnrrscmaatlriieenipellslnlsnnrlyrlddmssivqkapnlkilnlsg
    nelksereldkikglkleelwldgnslcdtfrdqstyisairerfpkllrldghelpppi
    af
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rw7B (B:)
    vrrdrapperggagtsqdgtsknwfkitipygrkydkawllsmiqskcsvpftpiefhye
    ntraqffvedastasalkavnykildrenrrisiiinssapphtilnelkpeqveqlkli
    mskrydgsqqaldlkglrsdpdlvaqnidvvlnrrscmaatlriieenipellslnlsnn
    rlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwldgnslcdtfrdqs
    tyisairerfpkllrldghelpppiaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rw7B (B:)
    elkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrscmaatlriiee
    nipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwl
    dgnslcdtfrdqstyisairerfpkllrldghelpppiaf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rw7C (C:)
    vrrdrapperggagtsqdgtsknwfkitipygrkydkawllsmiqskcsvpftpiefhye
    ntraqffvedastasalkavnykildrenrrisiiinssapphtilnelkpeqveqlkli
    mskrydgsqqaldlkglrsdpdlvaqnidvvlnrrscmaatlriieenipellslnlsnn
    rlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwldgnslcdtfrdqs
    tyisairerfpkllrldghelpppiaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rw7C (C:)
    knwfkitipygrkydkawllsmiqskcsvpftpiefhyentraqffvedastasalkavn
    ykildrenrrisiiinssapphelkpeqveqlklimskrydgsqqaldlkglrsdpdlva
    qnidvvlnrrscmaatlriieenipellslnlsnnrlyrlddmssivqkapnlkilnlsg
    nelksereldkikglkleelwldgnslcdtfrdqstyisairerfpkllrldghelpppi
    af
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3rw7D (D:)
    vrrdrapperggagtsqdgtsknwfkitipygrkydkawllsmiqskcsvpftpiefhye
    ntraqffvedastasalkavnykildrenrrisiiinssapphtilnelkpeqveqlkli
    mskrydgsqqaldlkglrsdpdlvaqnidvvlnrrscmaatlriieenipellslnlsnn
    rlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwldgnslcdtfrdqs
    tyisairerfpkllrldghelpppiaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rw7D (D:)
    lkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrscmaatlriieen
    ipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwld
    gnslcdtfrdqstyisairerfpkllrldghelpppiaf