PDB entry 3rw0

View 3rw0 on RCSB PDB site
Description: Crystal structure of the NavAb voltage-gated sodium channel (Met221Cys, 2.95 A)
Class: metal transport
Keywords: tetrameric ion channel, voltage-gated sodium-selective ion channel, membrane, METAL TRANSPORT
Deposited on 2011-05-06, released 2011-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.259
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ion transport protein
    Species: Arcobacter butzleri [TaxId:367737]
    Gene: Abu_1752
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8EVM5
      • expression tag (16-17)
      • engineered mutation (238)
    Domains in SCOPe 2.07: d3rw0a1, d3rw0a2
  • Chain 'B':
    Compound: Ion transport protein
    Species: Arcobacter butzleri [TaxId:367737]
    Gene: Abu_1752
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8EVM5 (18-End)
      • expression tag (16-17)
      • engineered mutation (238)
    Domains in SCOPe 2.07: d3rw0b1, d3rw0b2
  • Heterogens: PX4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rw0A (A:)
    mdykddddkgslvprgshmylritnivessfftkfiiylivlngitmgletsktfmqsfg
    vyttlfnqivitiftieiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlr
    vlrlfrlvtavpqmrkivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgt
    lgesfytlfqvmtleswsmgivrplmevypyawvffipfifvvtfvminlvvaiivdaca
    ilnqkeeqhiidevqshedninneiiklreeivelkeliktslkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rw0A (A:)
    shmylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitifti
    eiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrk
    ivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtles
    wsmgivrplmevypyawvffipfifvvtfvminlvvaiivdac
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rw0B (B:)
    mdykddddkgslvprgshmylritnivessfftkfiiylivlngitmgletsktfmqsfg
    vyttlfnqivitiftieiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlr
    vlrlfrlvtavpqmrkivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgt
    lgesfytlfqvmtleswsmgivrplmevypyawvffipfifvvtfvminlvvaiivdaca
    ilnqkeeqhiidevqshedninneiiklreeivelkeliktslkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rw0B (B:)
    shmylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitifti
    eiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrk
    ivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtles
    wsmgivrplmevypyawvffipfifvvtfvminlvvaiivdac