PDB entry 3rvv

View 3rvv on RCSB PDB site
Description: Crystal structure of Der f 1 complexed with Fab 4C1
Class: Hydrolase/IMMUNE SYSTEM
Keywords: complex between an allergen and Fab fragment of 4C1 antibody, Hydrolase-IMMUNE SYSTEM complex
Deposited on 2011-05-06, released 2012-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.153
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidase 1
    Species: Dermatophagoides farinae [TaxId:6954]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 4C1 - light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3RVV (0-End)
    Domains in SCOPe 2.06: d3rvvc1, d3rvvc2
  • Chain 'D':
    Compound: 4C1 - heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3RVV (0-End)
  • Heterogens: NAG, CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rvvC (C:)
    qivmtqspfsmyatlgervtitckasqdiysylswlqqkpgkslktliyranrlitgvps
    rfsgsgsgqdysltissleyedmgiyyclqydefpytfgggtklemkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rvvC (C:)
    qivmtqspfsmyatlgervtitckasqdiysylswlqqkpgkslktliyranrlitgvps
    rfsgsgsgqdysltissleyedmgiyyclqydefpytfgggtklemkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'D':
    No sequence available.