PDB entry 3rvu

View 3rvu on RCSB PDB site
Description: Structure of 4C1 Fab in C2221 space group
Class: immune system
Keywords: IgG, antibody, Der f 1, Der p 1, IMMUNE SYSTEM
Deposited on 2011-05-06, released 2012-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.214
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: 4C1 Fab - light chain
    Species: Mus musculus [TaxId:10090]
    Gene: Gm16939
    Database cross-references and differences (RAF-indexed):
    • PDB 3RVU (0-End)
    Domains in SCOPe 2.07: d3rvuc1, d3rvuc2, d3rvuc3
  • Chain 'D':
    Compound: 4C1 Fab - heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3RVU
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rvuC (C:)
    qivmtqspfsmyatlgervtitckasqdiysylswlqqkpgkslktliyranrlitgvps
    rfsgsgsgqdysltissleyedmgiyyclqydefpytfgggtklemkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rvuC (C:)
    qivmtqspfsmyatlgervtitckasqdiysylswlqqkpgkslktliyranrlitgvps
    rfsgsgsgqdysltissleyedmgiyyclqydefpytfgggtklemkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'D':
    No sequence available.