PDB entry 3rvt

View 3rvt on RCSB PDB site
Description: Structure of 4C1 Fab in P212121 space group
Class: immune system
Keywords: IgG, antibody, Der f 1, Der p 1, IMMUNE SYSTEM
Deposited on 2011-05-06, released 2012-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.195
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Fab fragment of 4C1 antibody - light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3RVT (0-212)
    Domains in SCOPe 2.07: d3rvtc1, d3rvtc2, d3rvtc3
  • Chain 'D':
    Compound: Fab fragment of 4C1 antibody - heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3RVT (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rvtC (C:)
    qivmtqspfsmyatlgervtitckasqdiysylswlqqkpgkslktliyranrlitgvps
    rfsgsgsgqdysltissleyedmgiyyclqydefpytfgggtklemkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'D':
    No sequence available.